Sequence: MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
FLJ25768/MGC120154/MGC120155/MM46; GABA(A) receptor-associated protein; Gamma-aminobutyric acid receptor-associated protein; hypothetical protein; MM46
Cat # 16177948
100 µg
Cat # 15720115
100 ug
Cat # 16881935
150 µL
Cat # 11504843
150 µL
Cat # 15943975
50 µL
Cat # 17126143
100 µL
Cat # 11511962
100 µL
Cat # 16556811
100 µL
Cat # 16057487
100 ug
Cat # 16184096
50 uL
Cat # 16808604
150 µL
Cat # 17147148
400 µL
Cat # 15365481
100 µg
Cat # 16891935
20 µL
Cat # 16367064
100 µl
Cat # 16262740
100 uL
Cat # 11554460
100 µg
Cat # 15774656
0.025 ml
Cat # 11524480
100 µg
Cat # 16167948
100 µg
Cat # 16082617
100 ug
Cat # 16357064
100 µl
Cat # 16818604
20 µL
Cat # 11554470
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.