Sequence: METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS
G0/G1 switch protein 2; G0/G1 switch regulatory protein 2; G0/G1switch 2; Putative lymphocyte G0/G1 switch gene; RP1-28O10.2
Cat # 16119382
100 µg
Cat # 16819603
20 µL
Cat # 16109382
100 µL
Cat # 16550592
100 µg
Cat # 16809603
150 µL
Cat # 15778605
0.05 ml
Cat # 16652444
100 µL
Cat # 17107683
100 µL
Cat # 16636734
100 µL
Cat # 16597461
100 µL
Cat # 15735006
0.1mL
Cat # 13267168
50 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.