Sequence: AGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQE
BJ-HCC-2 antigen; Cancer/testis antigen 43; CT43; FATE; fetal and adult testis expressed transcript protein; Fetal and adult testis-expressed transcript protein; Tumor antigen BJ-HCC-2
Cat # 16191077
200 uL
Cat # 15915684
100 µL
Cat # 15945674
100 µL
Cat # 16862455
20 µL
Cat # 16186423
100 µg
Cat # 16158820
100 µL
Cat # 15724891
100 µL
Cat # 16196423
50 µg
Cat # 16852455
150 µL
Cat # 15925684
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.