Sequence: MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPMVSSSSFLKAIGSSWTGWVLRCSMKPKHHSHLIEKFGEDRILTHLTGSISYTNWAGSRSLAVTVTEELLNLF
CDEP/MGC87400/PLEKHC2; Chondrocyte-derived ezrin-like protein; FERM, ARHGEF and pleckstrin domain-containing protein 1; FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived); FERM, RhoGEF and pleckstrin domain-containing protein 1; PH domain-containing family C member 2; Pleckstrin homology domain-containing family C member 2; protein phosphatase 1, regulatory subunit 75
Cat # 16186678
50 ug
Cat # 16591922
100 µg
Cat # 15633235
400 µL
Cat # 16162006
100 ug
Cat # 16039707
100 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.