Sequence: FLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNMQICGFKSTVPHFTEEEKYQKLLSENKIRDEQPKHQPD
FAM35A1/MGC5560/bA163M19.1; family with sequence similarity 35, member A; Protein FAM35A; RINN1-REV7-interacting novel NHEJ regulator 2; Shield complex subunit 2; Shieldin complex subunit 2
Cat # 16196410
100 uL
Cat # 16190919
100 ug
Cat # 17131964
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.