Sequence: KFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEK
family with sequence similarity 213, member A; peroxiredoxin (PRX)-like 2 activated in M-CSF stimulated monocytes; Peroxiredoxin-like 2 activated in M-CSF stimulated monocytes; Peroxiredoxin-like 2A; PRO2290/C10orf58/PAMM; Protein PAMM; Redox-regulatory protein FAM213A; redox-regulatory protein PAMM; UPF0765 protein C10orf58
Cat # 16104570
100 uL
Cat # 15783031
100 µL
Cat # 16173540
100 uL
Cat # 15740591
100 µL
Cat # 16376294
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.