Sequence: EHPCWEGGRGPARPTVCSPSSQPSLGSSTKFPSHRSVCGRDLAPLPRTQPHQSCAQQGPERVEPDDWTSTLMSR
C1orf183; family with sequence similarity 212, member B; HInca-r; Induced in neural crest by AP2-alpha protein-related homolog; Inka box actin regulator 2; PAK4-inhibitor INKA2
Cat # 16144860
100 uL
Cat # 15713621
100 µL
Cat # 15526662
100 µL
Cat # 16134860
100 uL
Cat # 15703621
100 µL
Cat # 15838763
100 µL
Cat # 15557162
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.