Sequence: RRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR
family with sequence similarity 174, member A; HCV NS5A-transactivated protein 6; Hepatitis C virus NS5A-transactivated protein 6; Membrane protein FAM174A; MGC17345/TMEM157/UNQ1912; Transmembrane protein 157
Cat # 16164020
100 uL
Cat # 15761951
100 µL
Cat # 16137699
200 uL
Cat # 16813305
150 µL
Cat # 16823305
20 µL
Cat # 16127699
50 ug
Cat # 15662365
50 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.