Sequence: MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
fatty acid binding protein 6, ileal; Fatty acid-binding protein 6; Gastrotropin; GT; I-15P; I-15P/I-BABP/I-BALB/I-BAP/ILBP/ILBP3/ILLBP; I-BABP; ILBP; ileal bile acid binding protein; Ileal lipid-binding protein; illeal lipid-binding protein; Intestinal 15 kDa protein; Intestinal bile acid-binding protein
Cat # 16114811
50 µg
Cat # 16303954
100 µL
Cat # 16314415
100 µg
Cat # 15712284
25 ug
Cat # 13458424
100 ug
Cat # 16324135
100 µL
Cat # 13481645
50 ug
Cat # 15760901
100 µL
Cat # 16124811
100 ug
Cat # 15923575
100 µL
Cat # 16313354
100 µL
Cat # 13209058
100 µL
Cat # 16177924
100 µg
Cat # 15674335
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.