Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
E-FABP; E-FABP/EFABP/PA-FABP/PAFABP; Epidermal-type fatty acid-binding protein; fatty acid binding protein 5 (psoriasis-associated); Fatty acid-binding protein 5; Fatty acid-binding protein, epidermal; PA-FABP; Psoriasis-associated fatty acid-binding protein homolog
Cat # 16157924
100 µg
Cat # 16174801
50 µg
Cat # 15934805
100 µg
Cat # 16868045
150 µL
Cat # 15577632
100 µg
Cat # 16243800
100 ug
Cat # 15953435
100 µL
Cat # 15954805
100 µg
Cat # 16147924
50 µg
Cat # 16878045
20 µL
Cat # 16860014
150 µL
Cat # 16307724
100 µL
Cat # 15944805
100 µg
Cat # 15523722
100 µg
Cat # 16870014
20 µL
Cat # 16578301
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.