Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
FABPL/L-FABP; fatty acid binding protein 1, liver; Fatty acid-binding protein 1; Fatty acid-binding protein, liver; L-FABP; Liver-type fatty acid-binding protein
Cat # 16194781
50 uL
Cat # 15583742
100 µg
Cat # 15568382
100 µg
Cat # 17136663
100 µL
Cat # 13423067
100 µL
Cat # 16164791
100 ug
Cat # 16130510
100 uL
Cat # 16851934
150 µL
Cat # 16695772
100 µL
Cat # 16124791
100 ug
Cat # 16144791
200 uL
Cat # 16197914
100 µL
Cat # 16154791
100 ug
Cat # 11501200
500 µg
Cat # 15697828
100 µg
Cat # 16134791
50 ug
Cat # 11591190
500 µg
Cat # 16387714
100 µL
Cat # 15537652
100 µg
Cat # 16861934
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.