Sequence: SGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDD
-; debranching enzyme homolog 1; Lariat debranching enzyme; RNA lariat debranching enzyme
Cat # 16136666
100 µg
Cat # 16130259
50 µg
Cat # 17224816
100 µL
Cat # 16875464
20 µL
Cat # 16626584
100 µL
Cat # 13405117
100 µL
Cat # 17274716
100 µL
Cat # 15755141
100 µL
Cat # 16865464
150 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.