Sequence: PVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW
DAZ-associated protein 2; deleted in azoospermia associated protein 2; Deleted in azoospermia-associated protein 2; KIAA0058/MGC14319/MGC766/PRTB; proline-rich transcript in brain; proline-rich transcript, brain-expressed protein
Cat # 16191286
50 uL
Cat # 17269073
100 µL
Cat # 16101296
100 µg
Cat # 15908174
100 µL
Cat # 16521272
100 µg
Cat # 16156318
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.