Sequence: SPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNG
BING2/DAP6/EAP1/MGC126245/MGC126246; CENP-C binding protein; Daxx; Death domain-associated protein 6; death-associated protein 6; death-domain associated protein; EAP1; ETS1-associated protein 1; Fas death domain-associated protein; Fas-binding protein; hDaxx
Cat # 16187024
100 ug
Cat # 16190090
100 µL
Cat # 13453767
100 µL
Cat # 16177024
50 uL
Cat # 16162680
100 ug
Cat # 17236823
100 µL
Cat # 16820035
150 µL
Cat # 16030787
100 ug
Cat # 13488784
100 ug
Cat # 16028986
100 ug
Cat # 16830035
20 µL
Cat # 17207863
100 µL
Cat # 16187950
100 uL
Cat # 16365654
100 µL
Cat # 11554592
100 µg
Cat # 16030177
100 ug
Cat # 16040396
100 uL
Cat # 11554941
100 µL
Cat # 16186957
100 µg
Cat # 15974705
100 µg
Cat # 15984705
100 µg
Cat # 15772614
25 ug
Cat # 12624625
100 µg
Cat # 16009935
100 ug
Cat # 16078806
400 uL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.