Sequence: TDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPI
28S ribosomal protein S29, mitochondrial; DAP-3; DAP-3/DKFZp686G12159/MGC126058/MGC126059/MRP-S29/MRPS29/bMRP-10; Death-associated protein 3; Ionizing radiation resistance conferring protein; mitochondrial 28S ribosomal protein S29; Mitochondrial small ribosomal subunit protein mS29; MRP-S29; S29mt
Cat # 16137975
100 µg
Cat # 13464177
100 µL
Cat # 16127975
50 uL
Cat # 16806563
150 µL
Cat # 15936164
100 µL
Cat # 16399794
100 µL
Cat # 16347654
100 µL
Cat # 16019457
100 ug
Cat # 11336013
100 µg
Cat # 11529832
100 µg
Cat # 16164498
100 µg
Cat # 16816563
20 µL
Cat # 16078576
100 ug
Cat # 13444177
100 µL
Cat # 15996144
100 µL
Cat # 16529381
100 µL
Cat # 11574640
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.