Sequence: MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
DAP-1; Death-associated protein 1; MGC99796
Cat # 16173891
100 ug
Cat # 15325491
100 µg
Cat # 15953375
100 µL
Cat # 16027497
100 ug
Cat # 17187543
100 µL
Cat # 16390045
100 µL
Cat # 15588742
100 µg
Cat # 16107950
100 uL
Cat # 16613375
100 µL
Cat # 16192310
100 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.