Sequence: PWGTFWPRPVSTGDLDRALPADTGLQKASADAELLGLLCQGVDIPLHVPDPKYRQDLVSQGGREVYPYPSPLHAVALQSPLFVLTKETPQ
C6orf116/DAPPER2/DPR2/FLJ31232/MGC133141/MGC133142/RP11-503C24.7/bA503C24.7; Dapper antagonist of catenin 2; Dapper homolog 2; dapper homolog 2, antagonist of beta-catenin; dapper, antagonist of beta-catenin, homolog 2; dishevelled-binding antagonist of beta-catenin 2
Cat # 16178490
100 µL
Cat # 15794321
100 µL
Cat # 15784321
100 µL
Cat # 12808782
100 µg
Cat # 16042207
100 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.