Sequence: MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL
Disheveled-associated activator of morphogenesis 1; FLJ41657/KIAA0666
Cat # 16164326
50 uL
Cat # 10067909
400 µL
Cat # 16883754
20 µL
Cat # 16873754
150 µL
Cat # 17177543
100 µL
Cat # 16636624
100 µL
Cat # 16044027
400 uL
Cat # 16369884
100 µL
Cat # 16184326
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.