Sequence: LGALPDKGDLMHDPAMDEELERLLAQVPGLVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET
FLJ22210/MGC4707; UPF0705 protein C11orf49
Cat # 16186110
100 uL
Cat # 16839714
20 µL
Cat # 15766911
100 µL
Cat # 16829714
150 µL
Cat # 15776991
100 µL
Cat # 16074447
100 uL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.