Sequence: NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL
BACAT; BACAT/BAT/FLJ20300/MGC104432; bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase); bile acid CoA:amino acid N-acyltransferase; bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase); Bile acid-CoA thioesterase; Bile acid-CoA:amino acid N-acyltransferase; Choloyl-CoA hydrolase; Glycine N-choloyltransferase; Long-chain fatty-acyl-CoA hydrolase
Cat # 16165124
100 ug
Cat # 16155124
50 uL
Cat # 16805424
150 µL
Cat # 16690105
100 µL
Cat # 16815424
20 µL
Cat # 13493177
100 µL
Cat # 15722321
100 µL
Cat # 16175124
100 µg
Cat # 16539581
100 µL
Cat # 15634295
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.